DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and SPINK6

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_995313.2 Gene:SPINK6 / 404203 HGNCID:29486 Length:80 Species:Homo sapiens


Alignment Length:83 Identity:24/83 - (28%)
Similarity:36/83 - (43%) Gaps:15/83 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLAMMALLGLLAIFFVSS--SEASYCPCN---------LRKAEV-CGTNGVTYQNRCVFECTQ 53
            ||...|..||.|....|::.  |:.....|.         .|::.. ||::|.||.|:|.| |  
Human     1 MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCAF-C-- 62

  Fly    54 REYRKLGRILNIKKMGSC 71
            :...|.|..:::|..|.|
Human    63 KAIVKSGGKISLKHPGKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 15/53 (28%)
SPINK6NP_995313.2 Kazal_1 36..80 CDD:395004 14/46 (30%)

Return to query results.
Submit another query.