DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and Kaz1-ORFB

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001027091.1 Gene:Kaz1-ORFB / 3772691 FlyBaseID:FBgn0063923 Length:115 Species:Drosophila melanogaster


Alignment Length:35 Identity:11/35 - (31%)
Similarity:14/35 - (40%) Gaps:4/35 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CPCNLRKAEVCGTNGVTYQN----RCVFECTQREY 56
            ||.......:||::.|.|.|    .|...|...||
  Fly    71 CPATSEYNPICGSDNVNYYNENKFNCALNCGLSEY 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 10/34 (29%)
Kaz1-ORFBNP_001027091.1 MFS <43..90 CDD:475125 6/18 (33%)
KAZAL_FS 69..>99 CDD:412159 8/27 (30%)

Return to query results.
Submit another query.