DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and LOC3290224

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:XP_565459.3 Gene:LOC3290224 / 3290224 VectorBaseID:AGAMI1_013908 Length:715 Species:Anopheles gambiae


Alignment Length:38 Identity:17/38 - (44%)
Similarity:19/38 - (50%) Gaps:5/38 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VCGTNGVTYQNRCVFECTQREYRKLGR-ILNIKKMGSC 71
            ||||:||||.||....|.    |..|. .|.|:..|.|
Mosquito   675 VCGTDGVTYSNRGKLRCA----RTCGNDDLEIRSYGEC 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 16/36 (44%)
LOC3290224XP_565459.3 None

Return to query results.
Submit another query.