DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and CG31704

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_723689.1 Gene:CG31704 / 318906 FlyBaseID:FBgn0051704 Length:68 Species:Drosophila melanogaster


Alignment Length:73 Identity:28/73 - (38%)
Similarity:40/73 - (54%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLAMMA--LLGLLAIFFVSSSEASYCPCNLRKAEVCGTNGVTYQNRCVFECTQREYRKLGRIL 63
            |:.||.:|  |..|||:......:.| |||......|||::.|||.|:||.:|..:|    ||.:
  Fly     1 MRCLAFIAFCLSALLAMAVGQVFQYS-CPCPRNYDPVCGSDSVTYSNQCVLDCLIKE----GRSI 60

  Fly    64 NIKKMGSC 71
            .::|.|.|
  Fly    61 TVEKKGRC 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 17/43 (40%)
CG31704NP_723689.1 KAZAL 26..68 CDD:197624 19/46 (41%)

Return to query results.
Submit another query.