DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and SPINK4

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_055286.1 Gene:SPINK4 / 27290 HGNCID:16646 Length:86 Species:Homo sapiens


Alignment Length:44 Identity:17/44 - (38%)
Similarity:22/44 - (50%) Gaps:3/44 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CNLRKAEVCGTNGVTYQNRCVFECTQREYRKLGRILNIKKMGSC 71
            |:.....||||:|:||.|.|.. |..|  .|..:.:.|.|.|.|
Human    46 CSQMSNLVCGTDGLTYTNECQL-CLAR--IKTKQDIQIMKDGKC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 16/42 (38%)
SPINK4NP_055286.1 KAZAL_FS 42..86 CDD:412159 16/42 (38%)

Return to query results.
Submit another query.