DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and CG44008

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster


Alignment Length:79 Identity:28/79 - (35%)
Similarity:40/79 - (50%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLAMMALLGLLAIFFVSSSEAS--------YCPCNLRKAEVCGTNGVTYQNRCVFECTQREYR 57
            ||||:::..|.||....:|.....        .|||......|||:|.|||.|||.|:|.:|...
  Fly     1 MKFLSILVALCLLLALTISPISCDDTEKVVRPICPCPRNYEPVCGSNLVTYPNRCEFDCVRRNVE 65

  Fly    58 KLGRILNIKKMGSC 71
            :.||.:.:.:.|:|
  Fly    66 RQGRSMGLLRDGTC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 18/43 (42%)
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 17/42 (40%)

Return to query results.
Submit another query.