DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and LOC1279932

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:XP_319718.1 Gene:LOC1279932 / 1279932 VectorBaseID:AGAMI1_009868 Length:63 Species:Anopheles gambiae


Alignment Length:72 Identity:24/72 - (33%)
Similarity:34/72 - (47%) Gaps:10/72 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLAMMALLGLLAIFFVSSSEASYCP-CNLRKAEVCGTNGVTYQNRCVFECTQREYRKLGRILN 64
            ||.|.:::.| |.||...:...:  || |......||||:|.||.|.|..|||      :...:.
Mosquito     1 MKLLFLLSFL-LCAILAAAGKYS--CPACPANYLPVCGTDGKTYANECALECT------VAPAVK 56

  Fly    65 IKKMGSC 71
            :.:.|.|
Mosquito    57 VARSGEC 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 15/44 (34%)
LOC1279932XP_319718.1 KAZAL 23..63 CDD:197624 16/45 (36%)

Return to query results.
Submit another query.