DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and spink2.3

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:XP_005157264.1 Gene:spink2.3 / 101882741 ZFINID:ZDB-GENE-141216-190 Length:76 Species:Danio rerio


Alignment Length:78 Identity:27/78 - (34%)
Similarity:33/78 - (42%) Gaps:14/78 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MMALLGLLAIFFVSSSEASYCP------------CNLRKAEVCGTNGVTYQNRCVFECTQREYRK 58
            |:|.:.||......::.|..||            |.:....||||:|.||.|.||. |......|
Zfish     1 MLAQIVLLLSLAAMATAADDCPSVPNCGKYHLPACTMDYRPVCGTDGNTYGNECVL-CGNIFKEK 64

  Fly    59 LGRILNIKKMGSC 71
            |..|| |.|.|.|
Zfish    65 LNIIL-ISKKGEC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 20/55 (36%)
spink2.3XP_005157264.1 KAZAL_FS 31..76 CDD:412159 19/46 (41%)

Return to query results.
Submit another query.