DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and spink2.5

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001373551.1 Gene:spink2.5 / 100538065 ZFINID:ZDB-GENE-141216-182 Length:76 Species:Danio rerio


Alignment Length:78 Identity:22/78 - (28%)
Similarity:33/78 - (42%) Gaps:14/78 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MMALLGLLAIFFVSSSEASYCP------------CNLRKAEVCGTNGVTYQNRCVFECTQREYRK 58
            |:|.:.||....|.::....||            |......||||:|:||.|.|  :...:.:.:
Zfish     1 MLAQIVLLLCLSVMATADDDCPLVPNCSRYHLPYCTKEHMPVCGTDGITYANEC--DLCAKMFEE 63

  Fly    59 LGRILNIKKMGSC 71
            ...|:.|.|.|.|
Zfish    64 KRNIILISKRGEC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 15/55 (27%)
spink2.5NP_001373551.1 Kazal_1 27..76 CDD:395004 14/50 (28%)

Return to query results.
Submit another query.