DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and spink2.9

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001373550.1 Gene:spink2.9 / 100538025 ZFINID:ZDB-GENE-141216-159 Length:76 Species:Danio rerio


Alignment Length:83 Identity:27/83 - (32%)
Similarity:35/83 - (42%) Gaps:24/83 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MMALLGLLAIFFVSSSEASYCP------------CNLRKAEVCGTNGVTYQNRC-----VFECTQ 53
            |:|.:.||....|.::.|..||            |.:....|||::|.||.|.|     :||   
Zfish     1 MLAQIVLLLCLSVMATAADKCPSVPNCSRYHPHACTMEYWPVCGSDGNTYGNECELCATIFE--- 62

  Fly    54 REYRKLGRILNIKKMGSC 71
               .||..|| |.|.|.|
Zfish    63 ---EKLNIIL-ISKKGEC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 19/60 (32%)
spink2.9NP_001373550.1 KAZAL 32..76 CDD:197624 18/50 (36%)

Return to query results.
Submit another query.