DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and Spink10

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:XP_002728606.3 Gene:Spink10 / 100361300 RGDID:2320365 Length:160 Species:Rattus norvegicus


Alignment Length:62 Identity:20/62 - (32%)
Similarity:28/62 - (45%) Gaps:13/62 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLAMMALLGLL--AIFFVSSSEASYCP-----------CNLRKAEVCGTNGVTYQNRCVF 49
            :|.:.::||:||.  ...|..|.:..:.|           |......||||||.||.|.|:|
  Rat    84 IKIIFILALVGLFYYETTFTFSKQVRHKPDCDKYKEFPNRCTREINPVCGTNGHTYDNECIF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 13/34 (38%)
Spink10XP_002728606.3 KAZAL_FS 37..>71 CDD:412159
Kazal_1 114..157 CDD:395004 12/32 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.