DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and Gm10267

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001268399.1 Gene:Gm10267 / 100042855 MGIID:3642556 Length:85 Species:Mus musculus


Alignment Length:44 Identity:16/44 - (36%)
Similarity:21/44 - (47%) Gaps:3/44 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CNLRKAEVCGTNGVTYQNRCVFECTQREYRKLGRILNIKKMGSC 71
            |......||.|||.||.|:|:| |.  .||:......:..:|.|
Mouse    45 CTREYFPVCATNGRTYFNKCIF-CL--AYRENDGSFIMSHLGKC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 15/42 (36%)
Gm10267NP_001268399.1 Kazal_1 41..85 CDD:395004 15/42 (36%)

Return to query results.
Submit another query.