DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42486 and Spink13

DIOPT Version :10

Sequence 1:NP_001162960.1 Gene:CG42486 / 8673962 FlyBaseID:FBgn0259989 Length:77 Species:Drosophila melanogaster
Sequence 2:XP_006525523.2 Gene:Spink13 / 100038417 MGIID:3642511 Length:137 Species:Mus musculus


Alignment Length:41 Identity:18/41 - (43%)
Similarity:23/41 - (56%) Gaps:3/41 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KAEVCGTNGVTYQNRCVFECTQREYRKLGRILNIKKMGSCQ 72
            ||.||.|||:||:|.|.| |..|  .:.|..:...|.|.|:
Mouse   100 KAYVCATNGLTYKNECFF-CIDR--WEFGPHIQFVKYGKCE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42486NP_001162960.1 KAZAL_FS 27..71 CDD:412159 17/38 (45%)
Spink13XP_006525523.2 KAZAL 95..136 CDD:197624 17/38 (45%)

Return to query results.
Submit another query.