DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42592 and CG34181

DIOPT Version :9

Sequence 1:NP_001163770.1 Gene:CG42592 / 8673955 FlyBaseID:FBgn0260969 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_001097130.1 Gene:CG34181 / 5740634 FlyBaseID:FBgn0085210 Length:203 Species:Drosophila melanogaster


Alignment Length:142 Identity:41/142 - (28%)
Similarity:73/142 - (51%) Gaps:20/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVCIAALIHLVLGISVSPWPPKDTCSPAPKVGAWIFTFAILLLVADVRMCPKGYTHVPYIIQVLG 70
            ||.:||...| :|.......|:|.|||||.:.:|:|..|.|..:.|:::.|:.:.|:....::|.
  Fly     5 AVGLAAFFQL-MGCYFFFAQPQDRCSPAPNLASWLFLGATLCFLWDIKIYPRRFMHMSRFWRILI 68

  Fly    71 ETVGSLIIIEFSTSVVWCALE----SVTHQLTRLLLLYWGMNGDTYLALE-----YWILLIPTTA 126
            |.|.|:.:.|..|.::|||||    |:|::|..|          |..:..     ||:..:.|:.
  Fly    69 EIVASIFLAEVGTVIIWCALEKFLFSLTNELVNL----------TQCSCRPSHFVYWLSGLITSL 123

  Fly   127 VASTFLYIMIKA 138
            ::...|:.:::|
  Fly   124 ISGAMLWYVLEA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42592NP_001163770.1 DUF4818 34..142 CDD:292707 29/114 (25%)
CG34181NP_001097130.1 DUF4818 32..140 CDD:292707 29/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C8YN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.