DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EIF3G and RnpS1

DIOPT Version :10

Sequence 1:NP_003746.2 Gene:EIF3G / 8666 HGNCID:3274 Length:320 Species:Homo sapiens
Sequence 2:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster


Alignment Length:126 Identity:25/126 - (19%)
Similarity:49/126 - (38%) Gaps:16/126 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   178 MQKELAEQLGLSTGEKEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIR 242
            :::|.:.....|...:.:..|.:|          :..||..|:.:..|..|..|.:     ..|.
  Fly   173 VKRERSRSASRSRSPRRRGRGSVE----------RTPPPKRRERSRSRTRSPSPKQ-----VRIH 222

Human   243 VTNLSEDTRETDLQELFRPFGSISRIYLAKDK-TTGQSKGFAFISFHRREDAARAIAGVSG 302
            |..|:.:..:..:.|:|..||.:..:....|: .....:|.||:.:...||...|:..:.|
  Fly   223 VGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATPEDCESAMKHMDG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EIF3GNP_003746.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
eIF3G 62..173 CDD:240597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..234 6/24 (25%)
RRM_eIF3G_like 240..315 CDD:409842 15/64 (23%)
RnpS1NP_649903.1 RRM_RNPS1 221..294 CDD:409800 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.