DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EIF3G and Ref2

DIOPT Version :10

Sequence 1:NP_003746.2 Gene:EIF3G / 8666 HGNCID:3274 Length:320 Species:Homo sapiens
Sequence 2:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster


Alignment Length:125 Identity:33/125 - (26%)
Similarity:55/125 - (44%) Gaps:15/125 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   193 KEKLPGELEPVQATQNKTGKYVPPSLRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQE 257
            |....|.|..:|.::|.||     .:|....::...::|.::.   ..:.|.||.....:.|:.|
  Fly    37 KRNSEGGLRGIQRSRNGTG-----FIRKSKFKQETLLKPPKKP---TLVMVCNLDYGVDDDDIME 93

Human   258 LFRPFGSISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYD------HLILN 311
            ||...|.:.:.::..|: .|.|.|.|.:||..||:|.:.|....|...|      ||:.|
  Fly    94 LFNQDGVVEKGFVHYDR-DGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQN 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EIF3GNP_003746.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..59
eIF3G 62..173 CDD:240597
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..234 4/24 (17%)
RRM_eIF3G_like 240..315 CDD:409842 24/78 (31%)
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 21/74 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.