DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EIF3F and eIF3f1

DIOPT Version :9

Sequence 1:NP_003745.1 Gene:EIF3F / 8665 HGNCID:3275 Length:357 Species:Homo sapiens
Sequence 2:NP_649489.1 Gene:eIF3f1 / 40587 FlyBaseID:FBgn0037270 Length:280 Species:Drosophila melanogaster


Alignment Length:277 Identity:133/277 - (48%)
Similarity:190/277 - (68%) Gaps:18/277 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    92 VRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNM 156
            ||:|||:|..:||::||||..:.||||||||:|||..|||||||.|||.|.:|:|..::.:|.:|
  Fly     8 VRVHPVVLFQVVDAFERRNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEHDDQVEAELSYALDM 72

Human   157 YELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLM 221
            |:|::||:.||.::||:|||:|:|.||.:|||||:||..||:|||||||||.|||.::|||...:
  Fly    73 YDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTSLQGGRMGLRAYVCIQL 137

Human   222 GVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSS-----------DLQQVGGA 275
            ||||...|.||||:.|:...|:.|..|:.|:.||       :|:|.           ||.|:..|
  Fly   138 GVPGGKSGCMFTPIPVELTSYEPETFGLKLLQKT-------VGVSPAHRPKTVPPMLDLAQISEA 195

Human   276 SARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYL 340
            |.::|..|..:|:|.:||::.||:.||.|||.|:.|::.||.:..:.|..|.|:|:.:||:|..|
  Fly   196 STKLQSLLDLILKYVDDVIAHKVTPDNAVGRQLLDLIHSVPHMTHEQFTQMFNANVRNLLLVITL 260

Human   341 ANLTQSQIALNEKLVNL 357
            :.|.::|:.|||||..|
  Fly   261 SQLIKTQLQLNEKLTFL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EIF3FNP_003745.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82
MPN_eIF3f 92..354 CDD:163695 130/272 (48%)
eIF3f1NP_649489.1 MPN_eIF3f 8..274 CDD:163695 130/272 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147331
Domainoid 1 1.000 139 1.000 Domainoid score I4803
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2783
Inparanoid 1 1.050 274 1.000 Inparanoid score I2990
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54712
OrthoDB 1 1.010 - - D1038775at2759
OrthoFinder 1 1.000 - - FOG0004972
OrthoInspector 1 1.000 - - oto88781
orthoMCL 1 0.900 - - OOG6_103242
Panther 1 1.100 - - LDO PTHR10540
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R381
SonicParanoid 1 1.000 - - X3506
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.