DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINA6 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:409 Identity:109/409 - (26%)
Similarity:193/409 - (47%) Gaps:45/409 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     4 LLYTCL-LWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISP 67
            :.|.|: ||:.     :|........|..:|..|                      ..:|:.:||
  Fly     1 MYYLCIFLWVT-----SVACQTSKEIYQLLSKSH----------------------TNQNLVVSP 38

Human    68 VSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALF 132
            |||...|:|:.:|..|.|..:|...||....::.......| ..|:.|..:.:..: :.:.|.::
  Fly    39 VSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYG-ALLNDLQGQEEGPI-LKLANRIY 101

Human   133 LDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLF--SGLDSPAIL 195
            ::....|.::::..::..::||..:::..:...|:.:||.:|.::|.|||..:.  ..:.|....
  Fly   102 VNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKA 166

Human   196 VLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNYVGN 260
            :|||.|:|||.|...||.|.||...|.|.....|.|.||.|..|....:..:|..|::::.|:.:
  Fly   167 LLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRDLDAQVIELPYLNS 231

Human   261 G---TVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEEMGIA 322
            .   |:|.....:|     ::||....:. ::..|.:.:|.|.:||..|....:|.:.||::||.
  Fly   232 NLSMTIFLPREVEG-----LSALEEKIVG-FARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIR 290

Human   323 DLFTNQANFSRITQD-AQLKSSKVVHKAVLQLNEEGVDTAGSTGVTL-NLTSKPIILRFNQPFII 385
            :|||::::.|.:..| :..|.|:|.|||.|::||||.:.||:|.|.: |.......|..:.||..
  Fly   291 ELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAVTNRAGFSTFLMADHPFAF 355

Human   386 MIFDHFTWSSLFLARVMNP 404
            :|.|..|  ..|..||::|
  Fly   356 VIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 98/365 (27%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 101/384 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.