DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINA6 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:425 Identity:100/425 - (23%)
Similarity:185/425 - (43%) Gaps:58/425 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    19 TVQAMD-PNAAYVN-MSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMALAMLSLGT 81
            |:.|:| |..:::| .|...:|    ..||:.:|.|.:..:.|..|:|.||.|...||.:....:
  Fly    16 TIAALDKPELSFLNEFSQIFKG----ERDFSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSS 76

Human    82 CGHTRAQLLQGL-------------GFNLTERSETEIHQGFQHLHQLFAKSDTSLEMTMGNALFL 133
            ...|..:|.|.|             .:.|.:|.:.            |....:.:|::..|.:|:
  Fly    77 SEQTERELAQALNLGWALNKQQVLVSYTLAQRQDE------------FRWRQSPMELSSANRIFV 129

Human   134 DGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKIVDLFSG--LDSPAILV 196
            |.::.:...|:..:  |..::.|... .|..|..::||.::.:||..:|.|:.|.  :....:||
  Fly   130 DRTINVSNKFNTLL--YGATKELDFK-NDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLV 191

Human   197 LVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQMNY---- 257
            |.|..:.||.|...|.:..|..:.|:::|.....|.||.::.......|..|..|::::.|    
  Fly   192 LANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIY 256

Human   258 ------------VGNGTVFFILPDKGK--MNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISG 308
                        ..:.::..|||:..|  :|.||:.|:.|::.:|.......:::|.:||.....
  Fly   257 KSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKKWFERALPQKIELSLPKFQFEQ 321

Human   309 VYDLGDVLEEMGIADLFTNQANFSRITQD-AQLKSSKVVHKAVLQLNEEGVDTAGSTGVTLNLTS 372
            ..:|..:|..||:..:||..|.|..:|.| ..|......|.|.::::|.|...|.:|.:.::.:|
  Fly   322 RLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSS 386

Human   373 K---PIILRFNQPFIIMIFDHFTWSSLFLARVMNP 404
            :   |.....|.||:.:|:|....:.||.....:|
  Fly   387 RQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 92/395 (23%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 93/399 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.