DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOCS1 and socs1a

DIOPT Version :9

Sequence 1:NP_003736.1 Gene:SOCS1 / 8651 HGNCID:19383 Length:211 Species:Homo sapiens
Sequence 2:NP_001003467.1 Gene:socs1a / 445073 ZFINID:ZDB-GENE-040801-205 Length:201 Species:Danio rerio


Alignment Length:213 Identity:89/213 - (41%)
Similarity:132/213 - (61%) Gaps:20/213 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVAH-----NQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS 60
            ||||     ||...|..|||.|          ||....:..:|||     .:.....|||:.|..
Zfish     1 MVAHSSVEGNQGIEDRQVSTEA----------SSDVFQSQRSRPR-----QSTVAFQTHFKPFNY 50

Human    61 HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTS 125
            ..|::.|:..:::|:..||||||::|..||.:|:.|.|||||:|||||.:.||.||.|..:||.|
Zfish    51 ARDFKIISNTTSMLEESGFYWGPMTVEEAHLKLKKESVGTFLIRDSRQSDVFFTLSYKAQNGPVS 115

Human   126 IRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGREN 190
            ||::|:..:|.|.||:||||.||:|||||:::|::.|..|.|:..|:.||:|||::|:.....::
Zfish   116 IRINFKNSKFSLTGSKESFDSLFKLLEHYISSPKKGLIRPCRKEPVQSLQQLCRRQIMERCDGKD 180

Human   191 LARIPLNPVLRDYLSSFP 208
            :..||:.|:|:|:|.:||
Zfish   181 IDCIPVQPILKDFLHAFP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOCS1NP_003736.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 16/56 (29%)
Kinase inhibitory region (KIR) 55..66 3/10 (30%)
Extended SH2 subdomain (ESS) 67..78 2/10 (20%)
SH2_SOCS1 68..165 CDD:198245 50/96 (52%)
SOCS_SOCS1 169..211 CDD:239704 15/40 (38%)
Interaction with Elongin BC complex. /evidence=ECO:0000250 173..182 5/8 (63%)
socs1aNP_001003467.1 SH2_SOCS1 58..155 CDD:198245 50/96 (52%)
SOCS 161..198 CDD:295349 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194332585
Domainoid 1 1.000 102 1.000 Domainoid score I25556
eggNOG 1 0.900 - - E1_KOG4566
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2776
Inparanoid 1 1.050 168 1.000 Inparanoid score I11433
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG48105
OrthoDB 1 1.010 - - D1135696at2759
OrthoFinder 1 1.000 - - FOG0010395
OrthoInspector 1 1.000 - - oto48122
orthoMCL 1 0.900 - - OOG6_118934
Panther 1 1.100 - - O PTHR10155
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10589
SonicParanoid 1 1.000 - - X7840
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 1 1.500 - -
1919.300

Return to query results.
Submit another query.