DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AKR1C3 and CG2767

DIOPT Version :9

Sequence 1:NP_001240837.1 Gene:AKR1C3 / 8644 HGNCID:386 Length:323 Species:Homo sapiens
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:326 Identity:120/326 - (36%)
Similarity:193/326 - (59%) Gaps:15/326 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     8 LKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADG 72
            |..|:|..|||:|.||:...:.....|::.   |:|||:||||:|.:|.||:.:|..::..:..|
  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAG 68

Human    73 SVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELS-PTDENGK 136
            .||||::|..:|:....:||..|.|.::.||:..|||||||||:|:|.::...|:.| ..|:.|.
  Fly    69 KVKREELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGL 133

Human   137 VIFDI-VDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRS 200
            :..|: .:....|.|||...:.||.||||||||::.|:..:|.  ..|.:|..||:|.|.|..:.
  Fly   134 MEVDVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQR 196

Human   201 KLLDFCKSKDIVLVAYSALGSQRDKRW-----VDPNSPVLLEDPVLCALAKKHKRTPALIALRYQ 260
            .|:|||||::|.:.|||.|||:...::     :..:.|.|::.|.:..:|..|.:|||.:.||:.
  Fly   197 DLVDFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWI 261

Human   261 LQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSF---ASHPNYPYSDE 322
            :..||..:.||.|..|::||:.||:|:||||::..:..||:|:...:...|   ..||.:.:.::
  Fly   262 IDTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTFKNQ 326

Human   323 Y 323
            |
  Fly   327 Y 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AKR1C3NP_001240837.1 ARA1 9..305 CDD:223729 115/302 (38%)
Tas 17..297 CDD:223739 109/286 (38%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 114/299 (38%)
Tas 10..297 CDD:223739 112/291 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.