DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RUNX3 and RunxA

DIOPT Version :9

Sequence 1:NP_001026850.1 Gene:RUNX3 / 864 HGNCID:10473 Length:429 Species:Homo sapiens
Sequence 2:NP_001259747.1 Gene:RunxA / 4379817 FlyBaseID:FBgn0083981 Length:663 Species:Drosophila melanogaster


Alignment Length:445 Identity:165/445 - (37%)
Similarity:204/445 - (45%) Gaps:109/445 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    22 STSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSP 86
            |.:.:.|||:||........||  .|..|:.              |::.|.|.:|.|||:||.||
  Fly    57 SNTEQNTPPTPAQLLNEAYTKM--TSDILAE--------------RTLGDFLTEHPGELIRTSSP 105

Human    87 NFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFND 151
            .|:|:|||.|||.|||||||||||:|||:.|||:|||.|||||||.|||||.:||||||||:|||
  Fly   106 LFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENYCAELRNCTAVMKNQVAKFND 170

Human   152 LRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR-RHRQKLEDQTKPFPDRFGDL 215
            |||||||||||||||||||.|||..:|||::||||||||||||| :....|..|.:.|...||  
  Fly   171 LRFVGRSGRGKSFTLTITVSTNPPHIATYNKAIKVTVDGPREPRSKTMLSLLGQQQQFHFAFG-- 233

Human   216 ERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDP 280
                              ....|||:.|         |:.|..|          |........:.
  Fly   234 ------------------QRPFHFSTDP---------LSGFRMP----------PIGNCQSASNT 261

Human   281 RMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYL-----------PPPYPGAPQNQS 334
            ...|..|.||..||.|:      |.||....|.:::|::..|           ...:.||.....
  Fly   262 HWGYGSAASAYSPYLAS------SGLSSCTTPTSAQFNNPALGFTCSSNDQSNNQDFGGATNRDC 320

Human   335 GPF----QANPSPYHL--YYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNP 393
            .|.    .|:....||  ..|::||......:.|:......|.|...||...||.:..||     
  Fly   321 VPMLPDSTASDLDQHLSSLVGSTSGQMTHHSLLGAGGQTSISSTVNGASGGGSAGAGTAG----- 380

Human   394 SLGGQSDGVEADG-----------------------SHSNSPTALSTPGRMDEAV 425
              ||...|..|.|                       |..|.|.:||...:.:..|
  Fly   381 --GGAGSGGGAGGGAGGNSILVPRYHTNASNEYNVHSSQNGPRSLSDSSQAESPV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RUNX3NP_001026850.1 Runt 76..197 CDD:307137 97/121 (80%)
Atrophin-1 <191..325 CDD:331285 31/145 (21%)
RunxI 330..429 CDD:312115 27/125 (22%)
RunxANP_001259747.1 Runt 95..216 CDD:279225 97/120 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2778
eggNOG 1 0.900 - - E1_KOG3982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3652
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000993
OrthoInspector 1 1.000 - - mtm8468
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11950
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X738
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.