DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OASL and dph1

DIOPT Version :9

Sequence 1:NP_003724.1 Gene:OASL / 8638 HGNCID:8090 Length:514 Species:Homo sapiens
Sequence 2:NP_594159.1 Gene:dph1 / 2542667 PomBaseID:SPAC26A3.16 Length:354 Species:Schizosaccharomyces pombe


Alignment Length:77 Identity:24/77 - (31%)
Similarity:42/77 - (54%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   432 SEIQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYGIQD 496
            :.|.:.:|..:...||..::..|.:|.||:.|.....:.|::|:|.:.|:||:|...|..|.|||
pombe     2 TNISLTIKAANDQKYAVTVDSESSVLALKEAIAPVADIEKERQRLIYAGRVLKDEESLKTYKIQD 66

Human   497 SDTLILSKKKGE 508
            ..::.|.|..|:
pombe    67 GHSIHLVKTLGQ 78

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
OASLNP_003724.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390
OAS1_C 168..351 CDD:313619