DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OASL and F14D2.11

DIOPT Version :9

Sequence 1:NP_003724.1 Gene:OASL / 8638 HGNCID:8090 Length:514 Species:Homo sapiens
Sequence 2:NP_494511.2 Gene:F14D2.11 / 184461 WormBaseID:WBGene00017459 Length:195 Species:Caenorhabditis elegans


Alignment Length:184 Identity:32/184 - (17%)
Similarity:61/184 - (33%) Gaps:43/184 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   332 QDCC--YDNRENPISSWNVKRARDIHLTVEQRGYPDFNLIVNPYEPIRKVKEKIRRT----RGYS 390
            |.||  ...|::.....|.....::|...:.:     ..::.....|||..:.::.|    ....
 Worm    38 QKCCEKISKRQDAQDEINTSILDELHKIQKNQ-----KKLLEEVGAIRKEVDSMKATTVKENEVK 97

Human   391 GLQRLSFQVPGSERQLLSSRCSLAKYGIFSHTHIYLLETIPSEIQVFVKNPDGGSYAYAINPNSF 455
            ..::||.      .::|..||...|                   ...:||.....:.|.:..|..
 Worm    98 DDRKLSL------NEMLRKRCLQVK-------------------NTKMKNSSMPKFQYFVRLNGK 137

Human   456 ILGLKQQIED--QQGLPK-----KQQQLEFQGQVLQDWLGLGIYGIQDSDTLIL 502
            ...|.....|  :||..:     :..::.:.|:.|.|.:..|.|.|.::.|:.|
 Worm   138 TRTLNVNASDTVEQGKMQLCHNARSTRMSYGGKPLSDQITFGEYNISNNSTMDL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OASLNP_003724.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390
OAS1_C 168..351 CDD:313619 5/20 (25%)
OASL_repeat1 354..433 CDD:176406 11/82 (13%)
ubiquitin 436..506 CDD:306702 16/74 (22%)
F14D2.11NP_494511.2 Ubiquitin_like_fold 128..195 CDD:391949 14/64 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D275600at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.