DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OASL and erich1

DIOPT Version :9

Sequence 1:NP_003724.1 Gene:OASL / 8638 HGNCID:8090 Length:514 Species:Homo sapiens
Sequence 2:NP_001120014.1 Gene:erich1 / 100144976 XenbaseID:XB-GENE-5807533 Length:304 Species:Xenopus tropicalis


Alignment Length:41 Identity:11/41 - (26%)
Similarity:16/41 - (39%) Gaps:3/41 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   149 ITVTIVPAYRALGPSLPNSQPPPEVYVSLIK---ACGGPGN 186
            :.|...|......|.:....||||.||:..:   .|..|.:
 Frog    53 VQVVFPPEELLKAPKVYTVLPPPEGYVASSQHESKCSSPSS 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OASLNP_003724.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390 11/41 (27%)
OAS1_C 168..351 CDD:313619 8/22 (36%)
OASL_repeat1 354..433 CDD:176406
ubiquitin 436..506 CDD:306702
erich1NP_001120014.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.