powered by:
Protein Alignment OASL and erich1
DIOPT Version :9
Sequence 1: | NP_003724.1 |
Gene: | OASL / 8638 |
HGNCID: | 8090 |
Length: | 514 |
Species: | Homo sapiens |
Sequence 2: | NP_001120014.1 |
Gene: | erich1 / 100144976 |
XenbaseID: | XB-GENE-5807533 |
Length: | 304 |
Species: | Xenopus tropicalis |
Alignment Length: | 41 |
Identity: | 11/41 - (26%) |
Similarity: | 16/41 - (39%) |
Gaps: | 3/41 - (7%) |
- Green bases have known domain annotations that are detailed below.
Human 149 ITVTIVPAYRALGPSLPNSQPPPEVYVSLIK---ACGGPGN 186
:.|...|......|.:....||||.||:..: .|..|.:
Frog 53 VQVVFPPEELLKAPKVYTVLPPPEGYVASSQHESKCSSPSS 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
NCBI |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.