DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK13 and Cdk9

DIOPT Version :9

Sequence 1:XP_016868239.1 Gene:CDK13 / 8621 HGNCID:1733 Length:1542 Species:Homo sapiens
Sequence 2:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster


Alignment Length:384 Identity:152/384 - (39%)
Similarity:221/384 - (57%) Gaps:39/384 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   703 DKFDIIGIIGEGTYGQVYKARD-KDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIIN 766
            :|::.:..||:||:|:|:|||: |...:.||:|||.:|||||||||||:|||:||:.|.|::::|
  Fly    48 NKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVN 112

Human   767 MKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKK 831
            :.||...|..|.:  ..:..|||||::.:|||.|||.:..|.|:...||..|:||:.||.|.|..
  Fly   113 LIEICRTKATATN--GYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSN 175

Human   832 NFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEESAWLMLIWEKVIFIWRILLMQMSAGSFGDS 896
            ..||||:|.:|:|:...|.:|||||||||.:|..::                           :|
  Fly   176 KILHRDMKAANVLITKHGILKLADFGLARAFSIPKN---------------------------ES 213

Human   897 SRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQELAQLELISRICG 961
            ...|||:|:||||||||||||:..|.|.:|:|..|||:.|::|:.||.|.|.|..||..||::||
  Fly   214 KNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCG 278

Human   962 SPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEF--VFIPAAALDLFDYMLALDPSKRCTAEQALQ 1024
            |..|.|||.|.:|..:.:::..|..:|:::|..  ........||.|.:|.|||.||..|:.||.
  Fly   279 SFTPDVWPGVEELELYKSIELPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALN 343

Human  1025 CEFL-RDVEP---SKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSL 1079
            .:|. .|..|   |||....|   |...|..::.||..:.......::|:....:|.|:
  Fly   344 HDFFWTDPMPSDLSKMLSQHL---QSMFEYLAQPRRSNQMRNYHQQLTTMNQKPQDNSM 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK13XP_016868239.1 None
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 138/327 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R186
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.