DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLPP3 and laza

DIOPT Version :10

Sequence 1:NP_003704.3 Gene:PLPP3 / 8613 HGNCID:9229 Length:311 Species:Homo sapiens
Sequence 2:NP_649391.1 Gene:laza / 40468 FlyBaseID:FBgn0037163 Length:334 Species:Drosophila melanogaster


Alignment Length:264 Identity:88/264 - (33%)
Similarity:137/264 - (51%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    62 YHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAAL 126
            :.|||:|:|.||:||.|.. ||...:|..:.:::.:|.:...|..||  .|:.|:.:   |...|
  Fly     4 FKRGFFCSDLSIRYPYKDC-TITVPMLLLMMLLLPMLFVAVVEIMRI--CKRFRTRL---YFRNL 62

Human   127 YKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNP------DFSQINCSEGYIQNYRCRGDD 185
            ::....|.||...:...|::||.::|||||||...|.|      ..|.:..:|.|::.:.|..::
  Fly    63 WRAEATFSFGFIATYLTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNNN 127

Human   186 ---SKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWR---GARLLRPLLQFTLIMMAFYTGLS 244
               .:::|...||.|.|:|.|.|:|:.|.||:..  .||   |.|:||.:|||.|:|.|....||
  Fly   128 LSTRQIRELHVSFPSAHSSLSFYSMVLLALYVHG--VWRGRGGVRVLRHVLQFLLLMAALCVSLS 190

Human   245 RVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFK--TKTTLSLPAPAIRKEILSPVDIIDRNNH 307
            ||:|:.||.||||||...|...|.....:|.:|.:  |.:|..:| |::.         ...:.|
  Fly   191 RVADYWHHWSDVLAGALLGVTYAAITAAYVGNLLRRQTSSTGRIP-PSLN---------YSHHLH 245

Human   308 HNMM 311
            |.:|
  Fly   246 HQLM 249

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity