DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLPP2 and CG11425

DIOPT Version :9

Sequence 1:NP_808211.1 Gene:PLPP2 / 8612 HGNCID:9230 Length:309 Species:Homo sapiens
Sequence 2:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster


Alignment Length:265 Identity:89/265 - (33%)
Similarity:127/265 - (47%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    52 PYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSDFNNY--VA 114
            |.||||:|.|:|:.|||..:|::..|:..:.:...:|.:...|::|.:      |.|...:  :.
  Fly    37 PTKRGFFCDDESLMYPYHENTVSPTLLHWLGLYLPLISLVVLESFLSH------RKDMAPWPTLW 95

Human   115 AVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVCDP---------DWSRVNCSVYVQLEKV 170
            .||..:..||:|...:..|..:.|..:|||||:|.|||.|         |.|......| ..:..
  Fly    96 PVYNTVRWFLYGYVSNDLLKGIGKQALGRLRPHFFAVCSPHFPDGSSCLDESHRGALKY-HTDYE 159

Human   171 CRGNPADVTE-----ARLSFYSGHSSFGMYCMVFLALYVQARLCWKW---ARLLRPTVQFFLVAF 227
            ||.|.:..||     ..:||.||||:...|.:||:||:::.|   :|   ..||.|.:|...||.
  Fly   160 CRPNLSQATEEMIRDVNVSFPSGHSAMAFYGLVFVALHLRRR---RWPLRGSLLSPVLQLACVAL 221

Human   228 ALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTVCYISDFFKARPPQHCLKEEELERKPSLSLTL 292
            |.:|..:||.|||||||||..|.|.|| .:||.|            ......|||:.:...||..
  Fly   222 AWFVAISRVIDYKHHWSDVAAGSLLGA-GSALAV------------TRAAASEELQWRCQDSLAS 273

Human   293 TLGEA 297
            ...||
  Fly   274 AKQEA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLPP2NP_808211.1 PAP2_wunen 115..261 CDD:239479 63/162 (39%)
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 64/175 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144683
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D434801at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.