DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLPP1 and CG11425

DIOPT Version :9

Sequence 1:NP_795714.1 Gene:PLPP1 / 8611 HGNCID:9228 Length:285 Species:Homo sapiens
Sequence 2:NP_649395.1 Gene:CG11425 / 40472 FlyBaseID:FBgn0037167 Length:305 Species:Drosophila melanogaster


Alignment Length:262 Identity:98/262 - (37%)
Similarity:148/262 - (56%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     2 FDKTRLPYVALDVLCVLLASMPMAVLKLGQIY--PFQRGFFCKDNSINYPYHDSTVTSTVLILVG 64
            |:.:..|.:.|.|..|||..:.:.|....:::  |.:|||||.|.|:.||||::||:.|:|..:|
  Fly     3 FNLSLRPPIRLLVDLVLLGLLIVLVENFRRLWGPPTKRGFFCDDESLMYPYHENTVSPTLLHWLG 67

Human    65 VGLPISSIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRP 129
            :.||:.|:::.|:.     |.|.........:..:|..:..||:|..::..|..|.|.::|||||
  Fly    68 LYLPLISLVVLESF-----LSHRKDMAPWPTLWPVYNTVRWFLYGYVSNDLLKGIGKQALGRLRP 127

Human   130 HFLDVCD---PDWSKINCSD----GYIEY---YICRGN-----AERVKEGRLSFYSGHSSFSMYC 179
            ||..||.   ||.|  :|.|    |.::|   |.||.|     .|.:::..:||.||||:.:.|.
  Fly   128 HFFAVCSPHFPDGS--SCLDESHRGALKYHTDYECRPNLSQATEEMIRDVNVSFPSGHSAMAFYG 190

Human   180 MLFVALYLQAR---MKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAI 241
            ::||||:|:.|   ::|.   ||.|.||...||::.:|.:|||.|||||||||..|.:.||..|:
  Fly   191 LVFVALHLRRRRWPLRGS---LLSPVLQLACVALAWFVAISRVIDYKHHWSDVAAGSLLGAGSAL 252

Human   242 LV 243
            .|
  Fly   253 AV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLPP1NP_795714.1 PAP2_wunen 99..244 CDD:239479 67/163 (41%)
CG11425NP_649395.1 PAP2_wunen 96..255 CDD:239479 67/164 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2766
OMA 1 1.010 - - QHG48083
OrthoDB 1 1.010 - - D1354951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.