DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RUNX1 and runx1

DIOPT Version :10

Sequence 1:NP_001745.2 Gene:RUNX1 / 861 HGNCID:10471 Length:480 Species:Homo sapiens
Sequence 2:XP_012813452.1 Gene:runx1 / 100485449 XenbaseID:XB-GENE-483164 Length:500 Species:Xenopus tropicalis


Alignment Length:39 Identity:13/39 - (33%)
Similarity:22/39 - (56%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


Human  1517 EKLTWLASERRMSQEGESEEENSQEENSEPEEEEEEEAE 1555
            ||:.....||:...|..:..|||::||.|.|..:.::|:
 Frog   237 EKVECYTFERKKRPEVLTIHENSRQENYETETVQVKQAK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RUNX1NP_001745.2 Runt 78..206 CDD:459963
RunxI 389..480 CDD:430037
runx1XP_012813452.1 Runt 51..179 CDD:459963
RunxI 407..500 CDD:430037
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.