DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RDH16 and Adhr

DIOPT Version :9

Sequence 1:NP_003699.3 Gene:RDH16 / 8608 HGNCID:29674 Length:317 Species:Homo sapiens
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:240 Identity:59/240 - (24%)
Similarity:95/240 - (39%) Gaps:73/240 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    77 LETVTLDVTK----------TESVAAAAQ------------WVKECVRDKGLWGLVNNAGISLPT 119
            |||..:.:||          ||:..|.||            |..:          |..|...:..
  Fly    20 LETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYD----------VTMAREDMKK 74

Human   120 APNELLTKQDFVTIL----------------DVNLLGVIDVTLSLLPLVRR----ARGRVVNVSS 164
            ..:|::.:.|::.:|                :.||.|:::...::||.:.|    ..|.:|||:|
  Fly    75 YFDEVMVQMDYIDVLINGATLCDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTS 139

Human   165 VMG-RVSLFGGGYCISKYGVEAFSDSLRRELSYF--GVKVAMIEPGYFKTAVTSKERFLKSFLEI 226
            |:| ..|.....|..||:||..|:.||...|.|.  ||.|..:..|..:..|   :|.||:||| 
  Fly   140 VIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFV---DRELKAFLE- 200

Human   227 WDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHA 271
                       ||:.|....:::..|....|.|:   :.|.:|.:
  Fly   201 -----------YGQSFADRLRRAPCQSTSVCGQN---IVNAIERS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RDH16NP_003699.3 NADB_Rossmann 30..305 CDD:304358 59/240 (25%)
adh_short 30..218 CDD:278532 45/185 (24%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 59/240 (25%)
adh_short 7..195 CDD:278532 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.