Sequence 1: | NP_003699.3 | Gene: | RDH16 / 8608 | HGNCID: | 29674 | Length: | 317 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608991.2 | Gene: | CG9150 / 33856 | FlyBaseID: | FBgn0031775 | Length: | 251 | Species: | Drosophila melanogaster |
Alignment Length: | 209 | Identity: | 56/209 - (26%) |
---|---|---|---|
Similarity: | 96/209 - (45%) | Gaps: | 25/209 - (11%) |
- Green bases have known domain annotations that are detailed below.
Human 28 RDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTL----DVTKTE 88
Human 89 SVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLT---KQDFVTILDVNLLGVIDVTLSLLP 150
Human 151 LVRR--ARGRVVNVSSVMGRVSL--------FGGGYCISKYGVEAFSDSLRRELSYFG--VKVAM 203
Human 204 IEPGYFKTAVTSKE 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RDH16 | NP_003699.3 | NADB_Rossmann | 30..305 | CDD:304358 | 56/207 (27%) |
adh_short | 30..218 | CDD:278532 | 56/207 (27%) | ||
CG9150 | NP_608991.2 | YdfG | 1..251 | CDD:226674 | 56/209 (27%) |
NADB_Rossmann | 1..247 | CDD:304358 | 56/209 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1880 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |