DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment PDLIM4 and Pax

DIOPT Version :9

Sequence 1:	NP_003678.2	Gene:	PDLIM4 / 8572	HGNCID:	16501	Length:	330	Species:	Homo sapiens
Sequence 2:	NP_001033913.1	Gene:	Pax / 35215	FlyBaseID:	FBgn0041789	Length:	581	Species:	Drosophila melanogaster

Alignment Length:	79	Identity:	27/79 - (34%)
Similarity:	39/79 - (49%)	Gaps:	10/79 - (12%)

- Green bases have known domain annotations that are detailed below.

Human   253 PECTRCGHGIVGTIVKARDKLYHPECFMCSDCGLNLKQRGYFFLDERL-YCESHAKAR------- 309
            |:|..|...|:...:.|.:..:||:||:|.||.... |.|.||..|.| |||:|..|:
  Fly   464 PKCNGCNRAIMENYISALNSQWHPDCFVCRDCRQPF-QGGSFFDHEGLPYCETHYHAKRGSLCAG 527

Human   310 -VKPPEGYDVVAVY 322
             .||..|..:.|::
  Fly   528 CSKPITGRCITAMF 541

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
PDLIM4	NP_003678.2	PDZ_signaling	2..80	CDD:238492
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	104..180
		DUF4749	148..220	CDD:406377
		LIM_RIL	255..307	CDD:188835	21/52 (40%)
Pax	NP_001033913.1	LIM1_Paxillin_like	348..400	CDD:259830
		LIM2_Paxillin_like	407..458	CDD:188723
		LIM3_Paxillin_like	466..518	CDD:188724	21/52 (40%)
		LIM4_Paxillin	525..576	CDD:188795	4/17 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1703
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810