DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YARS1 and AIMP1

DIOPT Version :9

Sequence 1:NP_003671.1 Gene:YARS1 / 8565 HGNCID:12840 Length:528 Species:Homo sapiens
Sequence 2:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster


Alignment Length:268 Identity:119/268 - (44%)
Similarity:155/268 - (57%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   294 DLEKDFAAEVVHPGDLKNSVEVALNKLLD------------PIREKFNT-------PALKKLASA 339
            :|.|:.||       |...||.||.:|:.            |....|.|       ||....|:|
  Fly    68 ELIKENAA-------LAKEVEAALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGPATA 125

Human   340 A----YPDPSKQ---------KPMAKGPAKNSE-PEEVIPSRLDIRVGKIITVEKHPDADSLYVE 390
            |    .|.|:|:         ||.|:.||...| |.:|  .|||:|||||:.|.:||||||||:|
  Fly   126 APAAPAPKPAKEPKEKKSKEKKPAAEKPAAAPEAPVDV--GRLDLRVGKIVEVGRHPDADSLYLE 188

Human   391 KIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPL 455
            |||.|||.|||||||||:|||.||:|:|||||:|||||.|||||.|:.|::|||..   .:||.|
  Fly   189 KIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCASTP---EKVEVL 250

Human   456 DPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNF-MTKLGSISC 519
            .||||:.||:.|..:||.: |||.:|.||||:||....|.|.:.|.:|.:|.... :...|::..
  Fly   251 SPPAGAVPGDLVHCEGYPR-QPDAQLNPKKKIFESCAPDLKTNGELVACYKGAALHVPGKGNVVA 314

Human   520 KSLKGGNI 527
            ::||..|:
  Fly   315 QTLKNVNV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YARS1NP_003671.1 nt_trans 8..328 CDD:320711 11/45 (24%)
'HIGH' region 44..52
'KMSKS' region 222..226
PRK12267 <327..528 CDD:330948 108/223 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..363 12/37 (32%)
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 69/105 (66%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D557463at33208
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.