DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YHK8 and CG33282

DIOPT Version :9

Sequence 1:NP_011914.1 Gene:YHK8 / 856444 SGDID:S000001090 Length:514 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:491 Identity:112/491 - (22%)
Similarity:192/491 - (39%) Gaps:103/491 - (20%)


- Green bases have known domain annotations that are detailed below.


Yeast    72 RYYISSLITFTSMVITM---ISSSWTLPSTHIIE------HFHIS-HEVSTLGITLYVFGLGIGP 126
            ||.:  |.|....:||.   :...|..|:...|:      .|.:: .::|.||..|.:..| .|.
  Fly    15 RYQL--LATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSL-CGN 76

Yeast   127 LFLSPLSELYGRRI-TFLYALTLSIIWQCLTIWSKTITGVMFGRFLSGFFGSAFLSVAGGAIADI 190
            |.::.|.|..||:. .:|.|...:.|| .|...:..:..:...|||.||.|.|...|....|:::
  Fly    77 LTIAMLIERAGRKFCLYLMAGPYACIW-ILIYCASNVYYLYAARFLCGFTGGAGYLVVPIFISEV 140

Yeast   191 FDKDQIGIPMAIYTTSAFLGPSLGPIIGGAL-YHQSYKWTFITLLITSGCCLVMIIFTIPETYKP 254
            .|.:..|...::...|..||...|.|:...| ||..   .|:.:::.....:..|:  :||| .|
  Fly   141 ADSNIRGALTSMVMLSVDLGILAGYILSTYLAYHVV---PFLAIILPVAYFIANIM--LPET-AP 199

Yeast   255 MLLIRKAKRLRKEKNDQRYY-----AVLEVTRE------QTSLLS-----AIFLSTKRPFGLLLR 303
            .||  |..:|...:|..|||     |:.|.|.:      :|::||     |..||.|   .|..:
  Fly   200 YLL--KKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYK---DLTTK 259

Yeast   304 DRMMGVLCFYTGLELAIIYLYFVAFPY------VFKKLYNFGPMEIACSYIGIMVGMILSAPTCL 362
            ..:.|   |...:.|::.|.:...|.:      :||...:...:..|...||::  .|:...|..
  Fly   260 PALKG---FAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLV--QIVGVYTST 319

Yeast   363 LFQKTFEWRVKRNNGVKTPEMRFEPLFYGAFLTPVGLFIFAFTCYKHV---------HWIAPIIG 418
            :.......||.         |....:       .||:...||.|:.::         :|: |::.
  Fly   320 ILVDIVGRRVL---------MLISTM-------GVGIGCIAFGCFTYLAKIYDLSDFNWL-PLVL 367

Yeast   419 SAIFG-------SGVYF-VFTGVFAYTVDAYRRYAASGMACNTFVRCIMAGVFPLFGLQMYKSMG 475
            ..|..       .|::| |...:|...:    |..|:.::. .|:..::.|...||.|.:: ..|
  Fly   368 MIIICYVANIGLIGIFFLVLVELFPVKI----RSLATSLSV-IFLSLLVFGTLKLFPLMLH-YWG 426

Yeast   476 VN---WAGFLLAMVTVAMIPVPFLFTKYGARLRAKS 508
            ::   |.....|::|.      |.|..:....:.||
  Fly   427 ISFTMWFSAASALLTF------FYFWLFLQETKGKS 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YHK8NP_011914.1 MFS_Tpo1_MDR_like 77..505 CDD:340881 108/481 (22%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 107/473 (23%)
MFS_1 53..409 CDD:284993 91/395 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.