DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APM2 and stnB

DIOPT Version :9

Sequence 1:NP_011844.1 Gene:APM2 / 856367 SGDID:S000001011 Length:605 Species:Saccharomyces cerevisiae
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:387 Identity:67/387 - (17%)
Similarity:135/387 - (34%) Gaps:116/387 - (29%)


- Green bases have known domain annotations that are detailed below.


Yeast   261 RTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISINKILNRDPQ 325
            |.:.:.|...|..:..::.:....||| |.|.|.:....:....:|:|||.:::.:|.:..:..:
  Fly   898 RERALTYKMEEVQVTAVDEITVEQDFE-GKILKQIARVRLFFLAFLTGMPTIELGVNDMWRQGKE 961

Yeast   326 FMSNS----------------SFHQCVSLDSINTIEKDEEKNSDDDAGLQAATDAREIEFIPPDG 374
            .:...                .||..|:       :|:.|:             .|.|:|.|||.
  Fly   962 VVGRHDIIPVATEEWIRLEAVEFHSVVN-------QKEYER-------------TRTIKFQPPDA 1006

Yeast   375 EFVLCQYELKRHVKDAPMVRLKDFEIK-PKLKKFKIQI---------VTKIQTNFKPTNSTSK-- 427
            .::    ||.|            |.:: ||.::..:|:         ..:::.:......||:  
  Fly  1007 NYI----ELLR------------FRVRPPKNRELPLQLKATWCVSGNKVELRADILVPGFTSRKL 1055

Yeast   428 -------LNVRIPLTKVFQEYKIDLSKQIRFKA------NIGKVVFNLSDDFLLWEIQTMKGHRE 479
                   ::||.|:.:.: .|...:.|..|:.:      ..||:   ...:.:|..:.|::....
  Fly  1056 GQIPCEDVSVRFPIPECW-IYLFRVEKHFRYGSVKSAHRRTGKI---KGIERILGAVDTLQESLI 1116

Yeast   480 HSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLEELYRQVHD 544
            ..|:..::|   |.............|...|..|...|...:.::..                :|
  Fly  1117 EVTSGQAKY---EHHHRAIVWRCPRLPKEGQGAYTTHQLVCRMALTS----------------YD 1162

Yeast   545 QQTSHVTPRDKLVNIDFEIP-----YCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVSDEEY 601
            |..|.:.|   ...::|.:|     :.|...:.|:....:||..:|     |||  ::..||
  Fly  1163 QIPSELAP---YAFVEFTMPATQVSHTTVRSVSVQDSDGDEPPEKY-----VRY--LARHEY 1214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APM2NP_011844.1 AP_Mu_N 3..138 CDD:341432
AP-1_Mu1_Cterm 256..603 CDD:271158 67/387 (17%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401 67/387 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10529
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.