DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIF3 and eIF4B

DIOPT Version :9

Sequence 1:NP_015489.1 Gene:TIF3 / 856292 SGDID:S000006367 Length:436 Species:Saccharomyces cerevisiae
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:377 Identity:86/377 - (22%)
Similarity:137/377 - (36%) Gaps:121/377 - (32%)


- Green bases have known domain annotations that are detailed below.


Yeast    91 EEYPVPDAPPYRAVINNIPWDITPEGVQAWVED-GLVKPEAVEEVVLPKNLRDPTRLKGNAFVTL 154
            ::..:|...|:.|.|||:|:|...:.:..:.|. .|:      .:.||:...:..|.:|..:|.|
  Fly    70 DDNSIPHKAPFIAYINNLPFDANEDDLYEFFEGINLI------SLRLPREDGENGRSRGFGYVEL 128

Yeast   155 KERADLVAVLKFNGTKLNERTVYVSVAAPRRGGGADVDWSSARGSNFQ-------GDGREDAPDL 212
            :.|.||:.||......:..|.:.:.::       .:.|..|.:.||.:       ||.|:..   
  Fly   129 ENREDLIHVLSLPDPSIKGRRIRIELS-------NENDQQSRQKSNRRFDGFGNNGDNRDSG--- 183

Yeast   213 DWGAARGSNFRGPRREREEVDIDWTAARGSNFQGSSRPPRREREEVDIDWSAARGSNFQGSSRPP 277
            :|           ||:.:.        .||||..|                    |||:   |..
  Fly   184 NW-----------RRDSQN--------NGSNFGYS--------------------SNFE---RSF 206

Yeast   278 RREREE-PDIDWSAARGSNFQSSSRPPRREREEPDIDWSAARGSNFQSSSRPPRREREKEEPALD 341
            .|||:. ||.|.....|| :::|:||       ..||.|            |.|||.|:......
  Fly   207 NRERKSLPDRDDVNTPGS-WRTSARP-------QSIDTS------------PTRREVEQVSEKYR 251

Yeast   342 WGAARGAQFGKPQQTKNTYKDRSLTN-KKTTDEQPKIQKSVYDVLRTEDDDEDE-EAEKQNGDAK 404
            .|..:.|.....::|....::|...| |..|...|.::     .:..|..|.|| ..:||.|.:.
  Fly   252 EGRVKIADRYSREETSKVEEERPKLNLKPRTLPLPDVK-----TIEFEKCDVDEFNLDKQGGTSS 311

Yeast   405 EN------KVDAAVEKLQ---------------------DKTAQLTVEDGDN 429
            .|      .||.|..:|:                     :|.|:|.|:..||
  Fly   312 LNVFGSAKPVDTAARELEIEQRLALARKQDKGRREQGLNEKLAELQVDKNDN 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIF3NP_015489.1 RRM4_RBM12_like 102..179 CDD:409936 20/77 (26%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 63/273 (23%)
RRM_eIF4B 79..155 CDD:240848 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105219
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1292
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.