DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DEGS1 and ifc

DIOPT Version :10

Sequence 1:NP_003667.1 Gene:DEGS1 / 8560 HGNCID:13709 Length:323 Species:Homo sapiens
Sequence 2:NP_476594.1 Gene:ifc / 33836 FlyBaseID:FBgn0001941 Length:321 Species:Drosophila melanogaster


Alignment Length:30 Identity:8/30 - (26%)
Similarity:13/30 - (43%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    23 CVPFFEVYASVLSGSRVWLYHELQSFDATA 52
            |.|  .:|:.......|::|..: .|..||
  Fly   231 CEP--GIYSLFALSEYVFVYSNI-GFHMTA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DEGS1NP_003667.1 Lipid_DES 6..42 CDD:462517 4/18 (22%)
Delta4-sphingolipid-FADS-like 26..315 CDD:239585 6/27 (22%)
Histidine box-1. /evidence=ECO:0000305 89..93
Histidine box-2. /evidence=ECO:0000305 128..132
Histidine box-3. /evidence=ECO:0000305 259..263
ifcNP_476594.1 Lipid_DES 6..42 CDD:462517
Delta4-sphingolipid-FADS-like 26..315 CDD:239585 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.