DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK10 and CDC28

DIOPT Version :9

Sequence 1:XP_011521707.1 Gene:CDK10 / 8558 HGNCID:1770 Length:392 Species:Homo sapiens
Sequence 2:NP_009718.3 Gene:CDC28 / 852457 SGDID:S000000364 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:123/338 - (36%)
Similarity:180/338 - (53%) Gaps:67/338 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    39 FEKLNRIGEGTYGIVYRARDT---QTDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVE 100
            :::|.::||||||:||:|.|.   |...:|||||:|::.|.:|:|.:::|||:||..|:..|||.
Yeast     8 YKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNIVR 72

Human   101 LKEVVVGNHLES--IFLVMGYCEQDLASLLENMP--TPFSEAQVKCIVLQVLRGLQYLHRNFIIH 161
            |.::|   |.::  ::||..:.:.||...:|.:|  .|.....||..::|:.:|:.|.|.:.|:|
Yeast    73 LYDIV---HSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILH 134

Human   162 RDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWVSK 226
            ||||..|||:...|.:|..|||||||:|||::..|.::|||||||||:|||....:|.:|.|   
Yeast   135 RDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTW--- 196

Human   227 GLAAVRSSVPRAGGVSRRLAAVRSTVLCRAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPS 291
                                         ::|||.||:...:|:..|.|||.||..|.::||||:
Yeast   197 -----------------------------SIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPN 232

Human   292 ENIWPGFSKLPLVGQYSLRKQPYNNLKHKFP-W-----------LSEAGLRLLHFLFMYDPKKRA 344
            |.|||....||             :.|..|| |           |...|:.||..|..|||..|.
Yeast   233 EAIWPDIVYLP-------------DFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRI 284

Human   345 TAGDCLESSYFKE 357
            :|.......||:|
Yeast   285 SARRAAIHPYFQE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK10XP_011521707.1 STKc_CDK10 31..371 CDD:173742 123/338 (36%)
PTZ00024 43..368 CDD:240233 122/334 (37%)
CDC28NP_009718.3 STKc_CDK1_CdkB_like 8..295 CDD:270829 120/334 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.