DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDK10 and Pitslre

DIOPT Version :9

Sequence 1:XP_011521707.1 Gene:CDK10 / 8558 HGNCID:1770 Length:392 Species:Homo sapiens
Sequence 2:NP_649251.2 Gene:Pitslre / 40292 FlyBaseID:FBgn0016696 Length:952 Species:Drosophila melanogaster


Alignment Length:364 Identity:173/364 - (47%)
Similarity:231/364 - (63%) Gaps:47/364 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    33 CRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPN 97
            ||||:||:.||||.|||||:||||:|.:|:||||||:::|:|||:|.||:|||||..||:.:|||
  Fly   552 CRSVEEFQCLNRIEEGTYGVVYRAKDKRTNEIVALKRLKMEKEKEGFPITSLREINTLLKGQHPN 616

Human    98 IVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPT---PFSEAQVKCIVLQVLRGLQYLHRNFI 159
            ||.::|:|||::::.||:||.|.|.||.||:|.|..   .|...:|||:..|:||.:.:||.|:|
  Fly   617 IVTVREIVVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNWI 681

Human   160 IHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWV 224
            :|||||.||||::.||.:|..||||||.||.|:|..|..|||||||||||||.:...:|.||:| 
  Fly   682 LHRDLKTSNLLLSHKGILKVGDFGLAREYGSPIKKYTSLVVTLWYRAPELLLCSPVYSTPIDVW- 745

Human   225 SKGLAAVRSSVPRAGGVSRRLAAVRSTVLCRAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGT 289
                                           :||||.||.|...||.||.|||.:::.|.:.|||
  Fly   746 -------------------------------SVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGT 779

Human   290 PSENIWPGFSKLPLV-------GQYSLRKQPYNNL-KHKFPWLSEAGLRLLHFLFMYDPKKRATA 346
            |:|.||||:::||.|       .|::  :.|.:.| ||.....||.||.||..|..||||:|.:|
  Fly   780 PNEKIWPGYTELPAVKNMLSQNSQFT--EYPVSQLRKHFQEKTSEMGLSLLQGLLTYDPKQRLSA 842

Human   347 GDCLESSYFKEKPLPCEPELMPTFP--HHRNKRAAPATS 383
            ...|:..:|||.|||.:|.:.||:|  .....|.|.|:|
  Fly   843 DAALKHGFFKELPLPIDPSMFPTWPAKSELGARKAQASS 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDK10XP_011521707.1 STKc_CDK10 31..371 CDD:173742 168/348 (48%)
PTZ00024 43..368 CDD:240233 159/335 (47%)
PitslreNP_649251.2 STKc_CDC2L1 552..851 CDD:173741 159/332 (48%)
PLN00009 555..854 CDD:177649 158/332 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0663
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D392617at33208
OrthoFinder 1 1.000 - - FOG0001516
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R970
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.