DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCR2 and Spf45

DIOPT Version :9

Sequence 1:NP_014200.1 Gene:GCR2 / 855522 SGDID:S000005143 Length:534 Species:Saccharomyces cerevisiae
Sequence 2:NP_001036426.1 Gene:Spf45 / 3355114 FlyBaseID:FBgn0086683 Length:403 Species:Drosophila melanogaster


Alignment Length:329 Identity:58/329 - (17%)
Similarity:114/329 - (34%) Gaps:98/329 - (29%)


- Green bases have known domain annotations that are detailed below.


Yeast   222 FDPQTGQILTQGRRKGNSLNTSTKGSPSDLQGINNGNNNGNNGNIG---------NGSNIK--NY 275
            :|||......:.:.|.|..:.:..| .||.:..::...:...|.:|         :..|:|  .:
  Fly    95 YDPQRPNEYEKLKEKSNGSDKNRAG-VSDREDRDDKEKDRKRGRVGRREFYRDEVSAPNLKLSGF 158

Yeast   276 GNKN--------MPNNRTKKRGTRVAKNAKNGKNNKNSNKERNGITDTSAFSNTTI--------- 323
            |::.        .|....|:.|..:|......:.:.:|..|   .|:|..:|.:::         
  Fly   159 GHRQNDDDMYLPSPGLVAKQGGATIAPPPSLQEMSIDSGCE---ATNTMPYSASSVAAKIMAKYG 220

Yeast   324 ---------SNPGTNMLFDPSLSQQLQKRLQTLSQDVNSRSLTGYYTQP--TSPGSGGFEFGL-- 375
                     |..|.      :::.|::|..:...:.::.:.:   :..|  .||.|.|.:.|.  
  Fly   221 FKDGQGLGKSEQGM------AIALQVEKTSKRGGRIIHEKDV---FLPPLALSPPSIGSQIGTSP 276

Yeast   376 SHADLNP------NASSNTMGYN---TMSNNGSHSWKRRSLGSLDVNTLDDEAVEELLQLTNTSK 431
            ||..:.|      .|.|..:||:   .|.:.......|..:|..||   |:|...|:....||..
  Fly   277 SHKAMPPPQMVDTAAESGDIGYSITEIMKSPSKVVLLRNMVGPGDV---DEELEPEVKDECNTKY 338

Yeast   432 RQRPMTTAAEGALINDGPDTNLNANNTQMKVDLNPSNSMGPIDTEAV-----IRPLKEAYDAIIS 491
            .:      ....:|::                     |.|.:..:||     .|.::.|..|::.
  Fly   339 GE------VNSVIIHE---------------------SFGTVPEDAVKIFVEFRRIESAIKAVVD 376

Yeast   492 EKGQ 495
            ..|:
  Fly   377 LNGR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCR2NP_014200.1 PHA03255 <30..>131 CDD:165513
Spf45NP_001036426.1 G-patch 209..248 CDD:279867 4/44 (9%)
RRM_UHM_SPF45 307..402 CDD:241091 18/104 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.