Sequence 1: | NP_003661.1 | Gene: | BHLHE40 / 8553 | HGNCID: | 1046 | Length: | 412 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524775.1 | Gene: | cwo / 44669 | FlyBaseID: | FBgn0259938 | Length: | 698 | Species: | Drosophila melanogaster |
Alignment Length: | 603 | Identity: | 113/603 - (18%) |
---|---|---|---|
Similarity: | 171/603 - (28%) | Gaps: | 287/603 - (47%) |
- Green bases have known domain annotations that are detailed below.
Human 44 KRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALT 108
Human 109 NLIDQQQQKIIALQSGLQ------------------AGELSGRNVETGQEMF----------C-- 143
Human 144 -------SG----------------FQTCAREVLQYLAKHENTRDLKSSQLVTHLHR-------- 177
Human 178 -VVSELLQ----------------------GGTSRKP--SDPAPKVMDFKEKPSSPAKG-SEGPG 216
Human 217 KN----------------C---------------VPVIQRTFAHSSGEQSGSD------------ 238
Human 239 -TDTDS---------------------------------GYGGESE----------KGDLR---- 255
Human 256 --------SEQPC-----FKSDHGRRFTMGERIGAIKQESEEPP-----TKKNRM---------- 292
Human 293 ----------------QLSDDEGHFTSSDL------------ISSPFL----------------- 312
Human 313 ---GPHPHQPPFCLPFYLIPPSATAYLP----------------MLEKCWYPTSVPVLYPGLNAS 358
Human 359 AAALSSFMNPDKISAPLL 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BHLHE40 | NP_003661.1 | Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer | 1..139 | 34/112 (30%) | |
bHLH-O_DEC1 | 40..129 | CDD:381592 | 30/102 (29%) | ||
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000269|PubMed:19786558 | 75..79 | 1/3 (33%) | |||
ORANGE | 140..184 | CDD:128787 | 15/87 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..303 | 36/280 (13%) | |||
cwo | NP_524775.1 | HLH | 66..118 | CDD:306515 | 21/54 (39%) |
ORANGE | 126..168 | CDD:128787 | 8/41 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165140978 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |