DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YHM2 and sea

DIOPT Version :9

Sequence 1:NP_013968.1 Gene:YHM2 / 855282 SGDID:S000004854 Length:314 Species:Saccharomyces cerevisiae
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:305 Identity:79/305 - (25%)
Similarity:128/305 - (41%) Gaps:58/305 - (19%)


- Green bases have known domain annotations that are detailed below.


Yeast     4 TTNTAAANVIEKKPVSFSNILLGACLNLSEVTTLGQPLEVVKTTM------AANRNFTFLESVKH 62
            |.:.|||  .:...|....|:.|......|: .:..|.|.|||.:      ||.:.....:.||.
  Fly    20 TEHGAAA--ADSGQVGLKGIVAGGITGGIEI-CITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKK 81

Yeast    63 VWSRGGILGYYQGL-------IPWAWIEASTKGAVLLFVSAEAEYRFKSLGLNNFASGILGGVTG 120
            .....|.||.|:||       ||    :::.:.....|:.:.|   ..|.|..:.:..:|.|:..
  Fly    82 TVGERGFLGLYRGLSVLVYGSIP----KSAARFGAFEFLKSNA---VDSRGQLSNSGKLLCGLGA 139

Yeast   121 GVTQAYLTMGFCTCMKTVE---ITRHKSAS------AGGVPQSSWSVFKNIYKKEGIRGINKGVN 176
            ||.:|.:.:   |.|:|::   |...:|.:      |.||.|        |.|.|||.||.||:.
  Fly   140 GVCEAIVAV---TPMETIKVKFINDQRSGNPKFRGFAHGVGQ--------IIKSEGISGIYKGLT 193

Yeast   177 AVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEK--IGA-SALGGGLSAW-NQPIEV 237
            ...::|.:|...||.:...::|..:       .||...|..|  :|. .|:.|..|.: |.|::|
  Fly   194 PTILKQGSNQAIRFFVLESLKDLYK-------GDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDV 251

Yeast   238 IRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRIG 282
            ::..||..  :.::.||  .......|.::.|....|:|..||:|
  Fly   252 VKTRMQGL--EASKYKN--TAHCAVEILKNEGPAAFYKGTVPRLG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YHM2NP_013968.1 Mito_carr 35..94 CDD:395101 17/71 (24%)
Mito_carr 109..192 CDD:395101 27/91 (30%)
Mito_carr 211..305 CDD:395101 21/76 (28%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 74/289 (26%)
Mito_carr 34..117 CDD:278578 21/87 (24%)
Mito_carr 125..220 CDD:278578 29/112 (26%)
Mito_carr 235..314 CDD:278578 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0756
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.