DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAL80 and CG13280

DIOPT Version :9

Sequence 1:NP_013661.1 Gene:GAL80 / 854954 SGDID:S000004515 Length:435 Species:Saccharomyces cerevisiae
Sequence 2:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster


Alignment Length:392 Identity:69/392 - (17%)
Similarity:126/392 - (32%) Gaps:120/392 - (30%)


- Green bases have known domain annotations that are detailed below.


Yeast    60 SIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWA 124
            ::|..:|.::.|  .:.:.|..|....:|::.|:.....|.|:...:|...      |::..|..
  Fly   131 ALAFAERHQVEN--VYTSFEDLAKCPNVDVVYISPLNPQHSELCHLMLNHD------KHVLCEKP 187

Yeast   125 LACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIEIA-------GNG 182
            |..:.:|...:.:.|..||:..:..:..|..|.....:..|.:..:|:|..:...       |..
  Fly   188 LCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAYHYLRHQILRNRLGEIKQVHCTLGLPVSQGRL 252

Yeast   183 GWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERG 247
            |.||.                   ||..||           .|..::...||..:|....:..|.
  Fly   253 GLYGG-------------------VTNDFG-----------VYGMQLALWVFREVPRCLKVSGRV 287

Yeast   248 NRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGK-------PTKKFTKNLVIDIHGTKGDLKL 305
            |          .:|       ::.:..:...|..||       ..||.:...|  |.|..|.:|:
  Fly   288 N----------SEH-------VDVSADIELCFTRGKRALIEVSSEKKLSNQAV--IQGKDGSIKM 333

Yeast   306 EGDAGFAEISNLVLYYSGTRA------NDFPLANGQQAPLDPGYDAGKEIMEVYHLRNYNAIVGN 364
            ..            |:..||.      .:|||..|.|.|....::......|...:||. .:.|:
  Fly   334 NN------------YWCPTRLITEEVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVRNC-ILKGS 385

Yeast   365 IHRLYQSISDFHFNTKKIPELPSQFVMQGFDFEGFPTLMDALILHRLIESVYKSNMMGSTLNVSN 429
            ...     .||..|                         ::|:|..|:::::....:|...|.:.
  Fly   386 TES-----DDFSHN-------------------------ESLLLANLMDTIHAELGVGEFANRNE 420

Yeast   430 IS 431
            :|
  Fly   421 VS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAL80NP_013661.1 MviM 17..429 CDD:223745 68/388 (18%)
CG13280NP_609812.1 MviM 89..387 CDD:223745 60/325 (18%)
GFO_IDH_MocA 92..213 CDD:279716 17/89 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1810
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001373
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.