DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAL80 and CG3597

DIOPT Version :9

Sequence 1:NP_013661.1 Gene:GAL80 / 854954 SGDID:S000004515 Length:435 Species:Saccharomyces cerevisiae
Sequence 2:NP_001259930.1 Gene:CG3597 / 33420 FlyBaseID:FBgn0031417 Length:337 Species:Drosophila melanogaster


Alignment Length:239 Identity:55/239 - (23%)
Similarity:91/239 - (38%) Gaps:58/239 - (24%)


- Green bases have known domain annotations that are detailed below.


Yeast    79 ESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLKYLFVEWALACSLDQAESIYKAAAERG 143
            ::.|....::::.:......||.||..:|...||      :..|..:..|::||:.:|..|.:||
  Fly    63 DALALDREVEVVYVGTLNPFHYAVVHLMLARGKN------VLCETPMCLSVEQAKELYTLAEQRG 121

Yeast   144 VQTI--ISLQGRKSPYILRAKELISQGYIGDINSIEIAGNGGWYGYERPVKSPKYIYEIGNGVDL 206
            |..:  .|:..|..|...|.:||:....||::..:::.     :|:.                  
  Fly   122 VFLMEGNSMWSRFFPSYDRLRELLKNDVIGEVTQVKVQ-----HGFR------------------ 163

Yeast   207 VTTTFGHTIDILQYMTSSYFSRINAMVFNNIPEQELIDERGNRLGQRVPKTVPDHLLFQGTLLN- 270
                       |.:|.......:...:..:|....|      :|||.|....|..:|..||.|| 
  Fly   164 -----------LAHMERVCNRSLGGSILMDIGIYAL------QLGQFVFGVSPVKILPSGTQLNK 211

Yeast   271 GNVPVSCSF-----KGGKPTKKFT--KNLVID--IHGTKGDLKL 305
            ..|.|...|     .|.:.....|  :||..|  |.||||::||
  Fly   212 ERVDVQIDFMLDYGDGRRLVALVTGLENLENDAVITGTKGEIKL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAL80NP_013661.1 MviM 17..429 CDD:223745 55/239 (23%)
CG3597NP_001259930.1 MviM 7..332 CDD:223745 55/239 (23%)
GFO_IDH_MocA 7..127 CDD:279716 17/69 (25%)
GFO_IDH_MocA_C 142..228 CDD:304482 22/125 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1810
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001373
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1924
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.