DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATR1 and CG33282

DIOPT Version :9

Sequence 1:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:247 Identity:52/247 - (21%)
Similarity:94/247 - (38%) Gaps:86/247 - (34%)


- Green bases have known domain annotations that are detailed below.


Yeast   136 KMLLVGYVLVIIWSLICGITKYSGSDTFF-IISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNI 199
            |..|.|:...|:.||  |. ::||..:|. .:|..|:..|....:.....|||.:.:.|.:...|
  Fly   259 KPALKGFAASIVLSL--GY-QFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTI 320

Yeast   200 VISFVG-----AMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTN 259
            ::..||     .::.:|..:||:               ||..::      ::..||.:.      
  Fly   321 LVDIVGRRVLMLISTMGVGIGCI---------------AFGCFT------YLAKIYDLS------ 358

Yeast   260 IHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLL 324
                ..:|:..||    :|::.:|.|              |.:|.:.|||:..::.::.      
  Fly   359 ----DFNWLPLVL----MIIICYVAN--------------IGLIGIFFLVLVELFPVKI------ 395

Yeast   325 PRAVIKDRHMIQIMLALFFG-----------WG-SF--------GIFTFYYF 356
             |::.....:|.:.| |.||           || ||        .:.||:||
  Fly   396 -RSLATSLSVIFLSL-LVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYF 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 52/247 (21%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 52/247 (21%)
MFS_1 53..409 CDD:284993 40/208 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.