DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJC5B and P58IPK

DIOPT Version :10

Sequence 1:NP_149096.2 Gene:DNAJC5B / 85479 HGNCID:24138 Length:199 Species:Homo sapiens
Sequence 2:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster


Alignment Length:78 Identity:32/78 - (41%)
Similarity:44/78 - (56%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     8 QRQRTLSTTGEA--LYEILGLHKGASNEEIKKTYRKLALKHHPD--KNPDDPAATEKFKEINNAH 68
            ||.:.|....|.  .|:|||:.:.||.:||.|.|||.|.|.|||  ::.:...|.:||.:|..|.
  Fly   383 QRAKKLQKQSERRDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAK 447

Human    69 AILTDISKRSIYD 81
            .:|||..||..:|
  Fly   448 EVLTDPEKRRQFD 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJC5BNP_149096.2 PRK10767 21..>84 CDD:236757 28/63 (44%)
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809
LapB 47..284 CDD:442196
TPR repeat 76..106 CDD:276809
TPR repeat 111..139 CDD:276809
TPR repeat 190..220 CDD:276809
LapB 196..>378 CDD:442196
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR repeat 341..371 CDD:276809
TPR repeat 376..399 CDD:276809 4/15 (27%)
PRK14278 395..>485 CDD:237654 28/66 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.