DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and HGTX

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster


Alignment Length:154 Identity:46/154 - (29%)
Similarity:68/154 - (44%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    10 PRTLLSIADILAPRMVPRAPSAPQLPESG----------PG----PTSPLCALEELTSKTFRGL- 59
            ||..::.|.....:.:.::..||....:|          ||    ..:|:...|.|::.....| 
  Fly   387 PRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLS 451

Human    60 DARALQPSEGRAGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGL 124
            .:....||..:.|           |::.:|..|:.||:..||:.|...||||..||..||..||:
  Fly   452 QSHQHHPSNDKDG-----------KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGM 505

Human   125 ANAQVVTWFQNRRAK-LKRDVEEM 147
            :.:||..||||||.| .||...||
  Fly   506 SESQVKVWFQNRRTKWRKRHAAEM 529

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 4/25 (16%)
Homeodomain 86..142 CDD:459649 26/56 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198