DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and E5

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster


Alignment Length:138 Identity:48/138 - (34%)
Similarity:59/138 - (42%) Gaps:20/138 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    20 LAPRMVPRA--PSAPQLPESGPGPTSPLCALEELTSKTFRGLDARALQP----SEGRAGPDALGP 78
            |.|..:|..  |..|......|....|..:...|..      |:..|.|    ..||..|..  |
  Fly   236 LPPGQIPLGIFPGGPHPGHPPPHGHHPFGSAPHLIR------DSYPLYPWLLSRHGRIFPRF--P 292

Human    79 G-----PFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRA 138
            |     || ||.::.||||:..|:|:||..|....|:..:||..||..|.|...||..||||||.
  Fly   293 GNFLFQPF-RKPKRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRT 356

Human   139 KLKRDVEE 146
            |.||..:|
  Fly   357 KHKRMQQE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 11/34 (32%)
Homeodomain 86..142 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
E5NP_524825.1 Homeodomain 304..360 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.