DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LBX2 and btn

DIOPT Version :10

Sequence 1:NP_001269359.1 Gene:LBX2 / 85474 HGNCID:15525 Length:198 Species:Homo sapiens
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:68 Identity:30/68 - (44%)
Similarity:37/68 - (54%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    86 RKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKR-DVEEMRA 149
            ||.||||:..|:.:||..|.:..||....|..:|..|.|...||..||||||.|.|| .:||.:.
  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQG 151

Human   150 DVA 152
            ..|
  Fly   152 SSA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LBX2NP_001269359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..89 2/2 (100%)
Homeodomain 86..142 CDD:459649 25/55 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..198
btnNP_732768.1 Homeodomain 87..143 CDD:459649 25/55 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.